PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun003287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family EIL
Protein Properties Length: 263aa    MW: 29631.9 Da    PI: 5.8848
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-136PU_refplantGDBView CDS
gnl|UG|Vun#S45876667PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN322.12.4e-071666300353
                XXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
       EIN3 300 ttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                + ++++v rkrk  + e +++  k  ++tc++ q+++s+ +l+f+d+ s+++++
  Vun003287  16 AVTNLDVLRKRK-VSNEFNMMDMK--IYTCEQPQCPYSQLQLGFPDRISRDNHR 66 
                455788888888.44555555555..6************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
XMGAVQQQSF SIKGEAVTNL DVLRKRKVSN EFNMMDMKIY TCEQPQCPYS QLQLGFPDRI  60
SRDNHRLICA FRGPSDFGGP NFHVNEVKPV IYPQSFVQPK PTTAAHSANM VTPVIDLTGL  120
EVSEDGKKRI SDLMTNYDTN VQGNKNMSSC NRVAVGGEVL NLPQQQDNFI RGRGITMEGN  180
VFDEATMSNN HHTFARDECQ FDRFKALNGP FETNHNNNNN NSNFHSMFGS FCDLASFDFK  240
EDMQGVVGMD GVQKPPDFSV WYQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146084.11e-156hypothetical protein PHAVU_006G011300g
TrEMBLV7BM201e-156V7BM20_PHAVU; Uncharacterized protein
STRINGGLYMA13G03660.11e-135(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.12e-28EIL family protein